PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10012205m
Common NameCICLE_v10012205mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 323aa    MW: 35922.1 Da    PI: 7.2377
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10012205mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.15.3e-15253295547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a+++eLe+kv  Le+eN++L+ 
  Ciclev10012205m 253 RRQKRMIKNRESAARSRARKQAYTQELENKVSRLEEENERLRR 295
                      79***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-14247298No hitNo description
SMARTSM003388.2E-14249316IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.886251300IPR004827Basic-leucine zipper domain
CDDcd147075.26E-23253299No hitNo description
PfamPF001701.8E-12253295IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-11253298No hitNo description
PROSITE patternPS000360256271IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGTQTMGSEG DAAAQAKNML SLTRQGSLYN LTLDEIQSQL GDRGKPLGSM NLDELLKSVW  60
TAENNFHSEP ALSLHRQGSL TLAQDLSNKT VDEVWKDIRQ KKSDDNQENE AQARQTSLGE  120
MTLEDFLVKA GAVNESTTPG QNNSGPGLEV DSIATVQQNV SQHAQWMQYQ LPSVQPQPQH  180
QHQHQNNLMA VYMPTHTIQQ SLPITANPVL DAQYPDNQMT MSPSSLMGAL SDTQAPGRKR  240
VASGAVVEKT VERRQKRMIK NRESAARSRA RKQAYTQELE NKVSRLEEEN ERLRRQRAEV  300
ILPCAPPPEP KYQLRRTGSA PF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430421.10.0hypothetical protein CICLE_v10012205mg
SwissprotQ9LES31e-105AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4T2E90.0V4T2E9_9R
STRINGSolyc10g081350.1.11e-118(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-92ABA-responsive element binding protein 3